Research Use Only — Not for Human Consumption. This compound is sold exclusively for in vitro laboratory research by qualified professionals.
IGF-LR3
IGF-1 Long R3 — Insulin-like Growth Factor-1 (1 mg)
IGF-LR3 (Long R3 IGF-1) is a synthetic analogue of IGF-1 comprising the full 70-amino acid sequence with an N-terminal 13-amino acid extension and an arginine substitution at position 3. These modifications reduce IGFBP binding affinity by approximately 1000-fold compared to native IGF-1, dramatically extending effective half-life and increasing availability for receptor activation. Research applications include studies of IGF-1 receptor signaling, cellular proliferation, muscle protein synthesis, and neuroprotection. For research use only — not for human consumption.
Third-Party Tested. Every Lot.
Every batch of IGF-LR3 undergoes independent HPLC and mass spectrometry analysis through an accredited third-party laboratory before it is released for sale. No exceptions. No internal-only certificates.
RP-HPLC Analysis
Every lot measured by reverse-phase HPLC. IGF-LR3 consistently achieves 99.0%+ purity across batches.
ESI Mass Spec
Electrospray ionization mass spectrometry confirms exact molecular weight and rules out structural isomers or impurities.
Lot-Specific CoA
Your Certificate of Analysis references your exact lot number with actual chromatogram data — not a generic template.
Theoretical Research Analysis
All research information below reflects published preclinical literature only. This product is not for human use, consumption, or clinical application of any kind.
IGF-LR3 is the standard tool for IGF-1 receptor research because its dramatically reduced IGFBP binding allows researchers to study receptor activation without the variable confound of endogenous binding protein competition.
Sequence Information
Amino acid sequence:
MFPAMPLSSL-GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSAMolecular Formula
C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular Weight
9117.47 g/mol
You May Also Like
View allCJC-1295
GHRH Analogue with DAC
Ipamorelin
Selective GH Secretagogue
Testagen 20 mg
Testagen — Thymic Tetrapeptide
Tesamorelin 10mg
Tesamorelin — GHRH(1-44) Analogue