15% off all orders — use code PEPTA15

Research Use Only — Not for Human Consumption. This compound is sold exclusively for in vitro laboratory research by qualified professionals.

PeptaPeptides
IGF-LR3
1 mg
99.0% PurityFor Research Use Only
RUO — Research Use Only
Not for human, veterinary, or clinical use
RUO
Secretagogue

IGF-LR3

IGF-1 Long R3 — Insulin-like Growth Factor-1 (1 mg)

(167 reviews)
99.0% Purity
$169.99per 1 mg · lyophilized

IGF-LR3 (Long R3 IGF-1) is a synthetic analogue of IGF-1 comprising the full 70-amino acid sequence with an N-terminal 13-amino acid extension and an arginine substitution at position 3. These modifications reduce IGFBP binding affinity by approximately 1000-fold compared to native IGF-1, dramatically extending effective half-life and increasing availability for receptor activation. Research applications include studies of IGF-1 receptor signaling, cellular proliferation, muscle protein synthesis, and neuroprotection. For research use only — not for human consumption.

3rd-Party HPLC Verified
Lot-Specific Certificate
Cold-Chain Shipping
Chemical Information
Molecular FormulaC₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular Weight9117.47 g/mol
CAS Number946870-92-4
FormLyophilized Powder
Storage-20°C, dry & dark
Purity (HPLC)≥ 99.0%
Amino Acid SequenceMFPAMPLSSL-GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
1
9 in stock — limited
Not for Human Consumption · For Research Purposes Only
256-bit SSL
Cold-Chain Shipping
Lot-Specific CoA
ISO 9001 Facility
Independent Verification

Third-Party Tested. Every Lot.

Every batch of IGF-LR3 undergoes independent HPLC and mass spectrometry analysis through an accredited third-party laboratory before it is released for sale. No exceptions. No internal-only certificates.

RP-HPLC Analysis

Every lot measured by reverse-phase HPLC. IGF-LR3 consistently achieves 99.0%+ purity across batches.

ESI Mass Spec

Electrospray ionization mass spectrometry confirms exact molecular weight and rules out structural isomers or impurities.

Lot-Specific CoA

Your Certificate of Analysis references your exact lot number with actual chromatogram data — not a generic template.

Research Context

Theoretical Research Analysis

All research information below reflects published preclinical literature only. This product is not for human use, consumption, or clinical application of any kind.

IGF-1 receptor signaling studies
Cellular proliferation and differentiation
Muscle protein synthesis research
Neuroprotection and neural growth studies
IGFBP-independent IGF-1 pharmacology

IGF-LR3 is the standard tool for IGF-1 receptor research because its dramatically reduced IGFBP binding allows researchers to study receptor activation without the variable confound of endogenous binding protein competition.

Sequence Information

Amino acid sequence:

MFPAMPLSSL-GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉

Molecular Weight

9117.47 g/mol

FDA Disclaimer: The information and statements contained on this website have not been evaluated by the United States Food and Drug Administration. The products offered by PeptaPeptides LLC and the statements made herein are not intended to diagnose, treat, cure, or prevent any disease or medical condition. PeptaPeptides LLC functions solely as a chemical supplier and raw material provider. PeptaPeptides LLC is not a compounding pharmacy, nor does it constitute a chemical compounding facility as that term is defined under Section 503A of the Federal Food, Drug, and Cosmetic Act. PeptaPeptides LLC is likewise not an outsourcing facility as defined under Section 503B of the Federal Food, Drug, and Cosmetic Act. All compounds and materials offered are provided exclusively for laboratory research, scientific analysis, and in vitro use by qualified researchers and institutions. None of the products available through PeptaPeptides LLC are intended for, approved for, or suitable for human consumption in any form.